DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxd3a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571200.1 Gene:hoxd3a / 30349 ZFINID:ZDB-GENE-990415-120 Length:396 Species:Danio rerio


Alignment Length:243 Identity:79/243 - (32%)
Similarity:102/243 - (41%) Gaps:72/243 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YHPYAQLFASKRKSSGFSNYEGCYPSP--PLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCT 168
            |.|..|.|:|       |:.|..|.||  |:......|......::.||              |.
Zfish    26 YGPTHQGFSS-------SSIENDYQSPICPIQTTSVRQATHKNGDINGS--------------CM 69

  Fly   169 SPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPL---KNHSSGGPVEITPLINDY------- 223
            .||||...|  ...:..|.|.......||.||:::..   |:.||.|....||:|:..       
Zfish    70 RPSASQGNS--QPESISEQQQAAPLAASSPSPSTNSTQKKKSPSSNGSSTATPVISKQIFPWMKE 132

  Fly   224 -------------------------ADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANR 263
                                     ..:|||:|||:||.||:|||:||..|.||.|.||:|:||.
Zfish   133 TRQNAKQKSTNCPAAGETCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANL 197

  Fly   264 LRLSEKQVKIWFQNRRVKQK-----KGGSESPTFNLSTNSNGSPQASP 306
            |.|:|:|:||||||||:|.|     ||...||.       ..||..||
Zfish   198 LNLTERQIKIWFQNRRMKYKKDQKSKGIMHSPL-------GHSPDRSP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
hoxd3aNP_571200.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..163 34/159 (21%)
Abdominal-A 116..237 CDD:332641 47/127 (37%)
Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 165..217 CDD:306543 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..246 8/27 (30%)
DUF4074 333..394 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.