DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxb3

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:282 Identity:92/282 - (32%)
Similarity:128/282 - (45%) Gaps:79/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQ--------QLPPIHN 148
            :|:..:..::..:|:..|    :|...|:|| .|:| .|.||..|..:.:        .|..:.|
  Rat     1 MQKATYYDNTAAALFGGY----SSYPGSNGF-GYDG-PPQPPFQAATHLEGDYQRSACSLQSLGN 59

  Fly   149 ---------LYGSPVVGGL---PLP-EPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSP 200
                     |.||.:..||   ||| .|||  ..|||:.:::...:||...| .|....:...|.
  Rat    60 AAPHAKSKELNGSCMRPGLAPEPLPAPPGS--PPPSAAPTSTTSNSNNGGGP-SKSGPPKCGASS 121

  Fly   201 NS----------------SPLKNH--------------------------SSGGPVEITPLINDY 223
            ||                |.|||.                          |.||..:.:|   ..
  Rat   122 NSTLTKQIFPWMKESRQTSKLKNSSPGTAEGCGGGGGGGGGGGSSSGGGGSGGGGGDKSP---PG 183

  Fly   224 ADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSE 288
            :.:|||.|||:||.||:|||:||..|.||.|.||:|:||.|.|||:|:||||||||:|.||   :
  Rat   184 SAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKK---D 245

  Fly   289 SPTFNLSTNSNG-SPQASPVSP 309
            .....|:::|.| ||..||..|
  Rat   246 QKAKGLASSSGGPSPAGSPPQP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 35/52 (67%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.