DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxc4a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571197.1 Gene:hoxc4a / 30345 ZFINID:ZDB-GENE-990415-112 Length:268 Species:Danio rerio


Alignment Length:241 Identity:85/241 - (35%)
Similarity:115/241 - (47%) Gaps:55/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SPGSLYHPYAQLFASKRKSSGFS-NYEGCYPSPPLS-----ANPNSQQLPPIHNLYGSPVVGGL- 158
            |..|....::..:.|:.:.||:. :::..|| |..|     .|..|...|.....:|.|..|.| 
Zfish    24 SQNSYIPEHSPEYYSRARDSGYQHHHQELYP-PRASYQERQYNCASIPEPDTQRGHGLPHAGHLL 87

  Fly   159 ---------PLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPV 214
                     |.|.|.|..| |||:|||.     |...|:          .||||.    |:..||
Zfish    88 GKGQSASCEPPPLPLSPAT-PSAASSAC-----NQATPE----------HPNSSA----SAKQPV 132

  Fly   215 --------EITPLINDYADSS-KRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQ 270
                    .::.:.:.|..:. ||.|||:|..|:||||:||.:|.||:|.||||||:.|.|||:|
Zfish   133 VYPWMKKIHVSTVNSSYNGAEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLVLSERQ 197

  Fly   271 VKIWFQNRRVKQKKG--------GSESPTFNLSTNSNGSPQASPVS 308
            :||||||||:|.||.        .|.|.| .:|:.||.|..|..|:
Zfish   198 IKIWFQNRRMKWKKDHRLPNTKVRSSSST-GISSGSNTSSAAGVVA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
hoxc4aNP_571197.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..129 23/78 (29%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeobox 157..210 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.