DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxb6a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio


Alignment Length:292 Identity:73/292 - (25%)
Similarity:108/292 - (36%) Gaps:108/292 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PGGSPTAAAAVAAAAMLPSIPMLPYP-ASYVGSYLFSLGIQQQQQ----QQQQQQQHAAAAAAA- 85
            |||..:....:...:...:.|:..|| |:|.||     .:|::..    .||....::.|.||. 
Zfish    15 PGGQESFLGQIPLYSSGYTDPLRHYPGAAYGGS-----SVQEKAYPSSFYQQANGAYSRATAAGP 74

  Fly    86 --------------AAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSA 136
                          |.|.|::::|..|.|.             ..||:.       |..|...|.
Zfish    75 CDYATASFYREKDPACALASIEEHSFVLSQ-------------DHRKTD-------CTGSTGKSI 119

  Fly   137 NPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPN 201
            .|.:.:..|...:|                                    |..:|.   :||:  
Zfish   120 YPEADEQKPSAPVY------------------------------------PWMQRM---NSCN-- 143

  Fly   202 SSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRL 266
                               ..:.::.:|.|..:|..|.||||:||..|.||:|.||||||:.|.|
Zfish   144 -------------------GTFGNAGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 189

  Fly   267 SEKQVKIWFQNRRVKQKKGGSESPTFNLSTNS 298
            :|:|:||||||||:|.||   |:...|.|..|
Zfish   190 TERQIKIWFQNRRMKWKK---ENKLINCSQTS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 2/40 (5%)
Homeobox 154..206 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.