DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxb4a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:232 Identity:77/232 - (33%)
Similarity:105/232 - (45%) Gaps:58/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCY-PSPPLSA-NPNSQQLPPIHNLYGS 152
            :|.:|.|  |....|:||        :|.......|..|. |..|.:. :|....||        
Zfish    38 SAQRQDP--SFQHESIYH--------QRSGCADPPYSSCQGPGQPAAVISPRGHVLP-------- 84

  Fly   153 PVVGGLPLPEPGSFCTS------PSASSSASLDYTNNFDE-------PQGKRFKHESSCSPNSSP 204
            ......|||||...|.|      |:...:.:...|:....       |..|:. |.:..||    
Zfish    85 TTALSTPLPEPSHHCDSVTPSPPPACGQTPTSQNTSTVSSRKDPVVYPWMKKV-HVNIVSP---- 144

  Fly   205 LKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEK 269
              |:|.|.|              ||.|||:|..|:||||:||.:|.||:|.||:|||:.|.|||:
Zfish   145 --NYSGGEP--------------KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSER 193

  Fly   270 QVKIWFQNRRVKQKKG----GSESPTFNLSTNSNGSP 302
            |:||||||||:|.||.    .::..:.:.||||:|.|
Zfish   194 QIKIWFQNRRMKWKKDHKLPNTKIRSNSASTNSSGCP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 24/104 (23%)
Antp-type hexapeptide 130..135 1/4 (25%)
Homeobox 154..207 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.