DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxb2a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:243 Identity:79/243 - (32%)
Similarity:109/243 - (44%) Gaps:76/243 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYG-SPVVGGLP 159
            |.:|...|:...|.:|    ||.:|.             .....:|..||..:..| :|:.||.|
Zfish    52 PSLSPCTGNQARPRSQ----KRTASN-------------GLQLRTQTAPPTQHQQGPAPLSGGAP 99

  Fly   160 L----------------PEPGSFCTSPSAS-SSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKN 207
            |                |:||:...:.:|| |.||..||                          
Zfish   100 LAHEFPWMKEKKSSKKCPKPGATAAAAAASPSQASSGYT-------------------------- 138

  Fly   208 HSSG--GPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQ 270
             ::|  .|.||...: |....|:|:|||:|:|||||||:||..|.||.|.||:|||..|.|:|:|
Zfish   139 -TAGLESPTEIQGGL-DNVSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQ 201

  Fly   271 VKIWFQNRRVKQKK-------GGSESPT-FNLSTNSNGSPQASPVSPQ 310
            ||:||||||:|.|:       |....|: |:|   ..|:..:||.|.|
Zfish   202 VKVWFQNRRMKHKRQTTHHRDGQEGEPSGFDL---LEGTDASSPYSSQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 6/18 (33%)
Antp-type hexapeptide 103..108 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 15/74 (20%)
Homeobox 162..214 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.