DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxd4a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:199 Identity:64/199 - (32%)
Similarity:89/199 - (44%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QHPHVSSSPGSLYHPY--AQLFASKRKSSGFSNYEGCYPSP-PLSANPNSQQLPPIHNLYGSPVV 155
            |||.:.|.......||  :.:..|..:..|....:...||| |    ..::|.|.: .:.||...
Zfish    66 QHPGIYSRSNYSEQPYSCSTVQGSSVQPRGHVQDQASTPSPFP----AQTEQCPAV-QISGSRTG 125

  Fly   156 GGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGP----VEI 216
            |                                    :.:::.:.|..|.|..:...|    |.:
Zfish   126 G------------------------------------QQQNTKTQNGIPTKQPAVVYPWMKKVHV 154

  Fly   217 TPLINDY-ADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRV 280
            |.:..|| ....||.|||:|..|:||||:||..|.||:|.||||||:.|.|||:|:||||||||:
Zfish   155 TTVNPDYTGPEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRM 219

  Fly   281 KQKK 284
            |.||
Zfish   220 KWKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.