DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxb5a

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_571176.2 Gene:hoxb5a / 30317 ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio


Alignment Length:227 Identity:74/227 - (32%)
Similarity:94/227 - (41%) Gaps:58/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ASKRKS----SGFSNYEGCYPSPPLSAN------------PNSQ--QLPPIHNLYGSPVVGGLPL 160
            ||.|.|    ||...|.  |....||.|            .||:  |.|.....:..|....|..
Zfish    33 ASYRDSGTMHSGSYGYN--YNGMDLSVNRSTSTGHFGAVGDNSRVFQSPAPETRFRQPSSCSLAS 95

  Fly   161 PEP------------GSFCTSPSASSSASLDYTNN-----FDEPQGKRFKHESSCSPNSSPLKNH 208
            |||            ||...|..::::|..:..:|     .||........|:|...|:|..:..
Zfish    96 PEPLPCSNSESLGPKGSSPPSDQSTTTAGNNLNSNTHFTEIDEASASSETEEASHRANNSAPRTQ 160

  Fly   209 --------------SSGGPVEITPLINDY-------ADSSKRIRTAFTSTQLLELEREFSHNAYL 252
                          |.|...:|.|.:...       ....||.|||:|..|.||||:||..|.||
Zfish   161 QKQETTATSTTSATSDGQAPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYL 225

  Fly   253 SRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK 284
            :|.||||||:.|.|||:|:||||||||:|.||
Zfish   226 TRRRRIEIAHALCLSERQIKIWFQNRRMKWKK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
hoxb5aNP_571176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..181 22/110 (20%)
Antp-type hexapeptide 182..187 2/4 (50%)
Homeobox 204..256 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.