DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Pdx1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus


Alignment Length:195 Identity:68/195 - (34%)
Similarity:90/195 - (46%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFK 193
            |..|||:.:|....|.  |:|   |...||..|.||.|   |:.:.      |...:||......
  Rat    68 YEVPPLADDPAGAHLH--HHL---PAQLGLAHPPPGPF---PNGTE------TGGLEEPSRVHLP 118

  Fly   194 HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRI 258
            .....|..:...|:..:||.....|      :.:||.|||:|..||||||:||..|.|:||.||:
  Rat   119 FPWMKSTKAHAWKSQWAGGAYAAEP------EENKRTRTAYTRAQLLELEKEFLFNKYISRPRRV 177

  Fly   259 EIANRLRLSEKQVKIWFQNRRVKQKK--------------GGSESPTFNLSTNSNGSPQASPVSP 309
            |:|..|.|:|:.:||||||||:|.||              ||.|.|..:.:..|.....|.|..|
  Rat   178 ELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPPPP 242

  Fly   310  309
              Rat   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
Pdx1NP_074043.4 Transactivation domain 13..73 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81 5/12 (42%)
Antp-type hexapeptide 118..123 0/4 (0%)
Homeobox 149..203 CDD:395001 32/53 (60%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.