DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Meox2

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus


Alignment Length:277 Identity:82/277 - (29%)
Similarity:111/277 - (40%) Gaps:94/277 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QHAAAAAAAAAAAAALQQHPHVSSSPG----SLYHPYAQLFASKRKS--SGFSNYEGCYPS---- 131
            :|.......:..|.|...||...||..    |.:..|.:|..|....  :|:.|.||.:.|    
  Rat     2 EHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHR 66

  Fly   132 ---------------------------PPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGS---- 165
                                       |.:|:.|::.:    |:|...|..|| | ||.||    
  Rat    67 GHHHHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAAR----HSLCLQPDSGG-P-PELGSSPPV 125

  Fly   166 FC--------TSPSASSSASLDYTNNFDEP------QGKRFKHESSCSP--------NSSPLKNH 208
            .|        ::|:.::.|..||......|      .|.:.|.:||.|.        ||.|.|. 
  Rat   126 LCSNSSSLGSSTPTGAACAPGDYGRQALSPAEVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKE- 189

  Fly   209 SSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKI 273
                                  |||||..|:.|||.||:|:.||:||||.|||..|.|:|:|||:
  Rat   190 ----------------------RTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKV 232

  Fly   274 WFQNRRVKQK--KGGSE 288
            ||||||:|.|  |||.:
  Rat   233 WFQNRRMKWKRVKGGQQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 35/57 (61%)
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 28/156 (18%)
Homeodomain 187..243 CDD:459649 35/78 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.