DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Meox2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus


Alignment Length:277 Identity:82/277 - (29%)
Similarity:111/277 - (40%) Gaps:94/277 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QHAAAAAAAAAAAAALQQHPHVSSSPG----SLYHPYAQLFASKRKS--SGFSNYEGCYPS---- 131
            :|.......:..|.|...||...||..    |.:..|.:|..|....  :|:.|.||.:.|    
  Rat     2 EHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHR 66

  Fly   132 ---------------------------PPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGS---- 165
                                       |.:|:.|::.:    |:|...|..|| | ||.||    
  Rat    67 GHHHHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAAR----HSLCLQPDSGG-P-PELGSSPPV 125

  Fly   166 FC--------TSPSASSSASLDYTNNFDEP------QGKRFKHESSCSP--------NSSPLKNH 208
            .|        ::|:.::.|..||......|      .|.:.|.:||.|.        ||.|.|. 
  Rat   126 LCSNSSSLGSSTPTGAACAPGDYGRQALSPAEVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKE- 189

  Fly   209 SSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKI 273
                                  |||||..|:.|||.||:|:.||:||||.|||..|.|:|:|||:
  Rat   190 ----------------------RTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKV 232

  Fly   274 WFQNRRVKQK--KGGSE 288
            ||||||:|.|  |||.:
  Rat   233 WFQNRRMKWKRVKGGQQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 28/156 (18%)
Homeobox 190..243 CDD:395001 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.