DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Gsx1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001178592.1 Gene:Gsx1 / 288457 RGDID:1310020 Length:261 Species:Rattus norvegicus


Alignment Length:295 Identity:100/295 - (33%)
Similarity:127/295 - (43%) Gaps:93/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSFLMDSLLSDRPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLPY--PASYVGSYLFSL 63
            |.||||:|||:     |.:..:| .:|.|||.              |:.||  |..:.       
  Rat     1 MPRSFLVDSLV-----LREASDK-KAPEGSPP--------------PLFPYAVPPPHA------- 38

  Fly    64 GIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGC 128
                         .|..:..|..|..|.|.....:..:...|:.|                    
  Rat    39 -------------LHGLSPGACHARKAGLLCVCPLCVTASQLHGP-------------------- 70

  Fly   129 YPSPP----LSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQG 189
             |.||    |.|:     .||..:.|....:|......|| ...||:|:::|:..|..::..|..
  Rat    71 -PGPPALPLLKAS-----FPPFGSQYCHAPLGRQHSVSPG-VAHSPAAAAAAAALYQTSYPLPDP 128

  Fly   190 KRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSR 254
            ::| |..|...:|:.|                   .||||:||||||||||||||||:.|.||||
  Rat   129 RQF-HCISVDSSSNQL-------------------PSSKRMRTAFTSTQLLELEREFASNMYLSR 173

  Fly   255 LRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSES 289
            |||||||..|.||||||||||||||||.||.|..|
  Rat   174 LRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 45/51 (88%)
Gsx1NP_001178592.1 Homeobox 150..202 CDD:278475 45/51 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7019
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341872at2759
OrthoFinder 1 1.000 - - FOG0005158
OrthoInspector 1 1.000 - - otm44565
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.