DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxd4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:254 Identity:82/254 - (32%)
Similarity:103/254 - (40%) Gaps:78/254 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GSLYHPYAQLFASKRKSSGFSNYEGCYPSP-------------PLSA-----------NPNSQQL 143
            |.|....|..:.|..:.|.|.. .|.||.|             |.||           .|.|...
  Rat    27 GYLGEQGADYYGSGAQGSDFQP-PGLYPRPDFGEQPFGGGGPGPGSALPARGHGQEPSGPGSHYS 90

  Fly   144 PPIHNLYGSPVVGGLPLPEPGS-FCTSPSASSSASLDYTNNFDEPQGKRFK------------HE 195
            .|     |.|.....|.|.||: .|:.|          |.....|.|...|            |.
  Rat    91 AP-----GEPCPAPPPAPLPGARACSQP----------TGPKQPPPGTALKQPAVVYPWMKKVHV 140

  Fly   196 SSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEI 260
            :|.:|      |::.|.|              ||.|||:|..|:||||:||..|.||:|.|||||
  Rat   141 NSVNP------NYTGGEP--------------KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEI 185

  Fly   261 ANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNG--SPQASP---VSPQVKVH 314
            |:.|.|||:|:||||||||:|.||......|...|::|:.  |..|:|   :.|..|.|
  Rat   186 AHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSCSSSAAPSQHLQPMAKDH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.