DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxd1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001099354.1 Gene:Hoxd1 / 288151 RGDID:1309179 Length:328 Species:Rattus norvegicus


Alignment Length:341 Identity:94/341 - (27%)
Similarity:130/341 - (38%) Gaps:94/341 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLP-------------YPASYVGSYLFSLGI 65
            ||...|....|||..|:..:...:|||...||.|:.|             .|.:..|:|      
  Rat    36 RPVALQPAFPLGSGDGAFVSCLPLAAARPTPSPPVAPAQPPGPQPAASRYAPCTLEGAY------ 94

  Fly    66 QQQQQQQQQQQQHAAAAAAA---------------AAAAAALQQHPHVSSSPGSLYHPYAQLFAS 115
                      ::.||.|:||               |...||....|||..:..:::........|
  Rat    95 ----------ERGAAPASAAEYGFLGSGPAFDFPGALGRAADDSGPHVHYATSAVFSSGGSFLLS 149

  Fly   116 KRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDY 180
            .:..  |:.:....|.|.....|......|...:  ||..|..|.|      .||::...|:   
  Rat   150 GQVD--FAAFAEPGPFPACLKEPADGHPGPFQTV--SPAPGACPKP------ASPTSGLPAA--- 201

  Fly   181 TNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELERE 245
            .:.|:..:.||      .:|..|.|..:.:..|             |..|||.|::.||.|||:|
  Rat   202 HSTFEWMKVKR------NAPKKSKLSEYGATSP-------------SSAIRTNFSTKQLTELEKE 247

  Fly   246 FSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK------------------GGSESPTF 292
            |..|.||:|.||:||||.|:|::.||||||||||:||||                  .|||:...
  Rat   248 FHFNKYLTRARRMEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASLQLPGSETSPI 312

  Fly   293 NLSTNSNGSPQASPVS 308
            ....|.....||...|
  Rat   313 KSGRNLGSPSQAQEPS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 33/51 (65%)
Hoxd1NP_001099354.1 COG5576 <208..325 CDD:227863 49/135 (36%)
Homeobox 233..285 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.