DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and VENTX

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:200 Identity:63/200 - (31%)
Similarity:85/200 - (42%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LSANP--NSQQLPPIHN---LYGSPVVGGLPLPEPGSF----CTSPSASSSASLDYTNNFDEPQG 189
            ||::|  ..|||....:   |..|...|....|.|..|    ...|..:|.|.       :.||.
Human     3 LSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAR-------EPPQA 60

  Fly   190 KRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSR 254
            ...| |::.|.|....:...:|...|...|      .:.|:|||||..|:..||..|.|:.|||.
Human    61 VSIK-EAAGSSNLPAPERTMAGLSKEPNTL------RAPRVRTAFTMEQVRTLEGVFQHHQYLSP 118

  Fly   255 LRRIEIANRLRLSEKQVKIWFQNRRVKQKK------------GGSESPTFNLSTNS---NGSPQA 304
            |.|..:|..::|||.|:|.||||||:|.|:            |...:|....||:|   ||....
Human   119 LERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLL 183

  Fly   305 SPVSP 309
            .|.:|
Human   184 CPWAP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 29/55 (53%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 24/103 (23%)
Homeodomain 93..148 CDD:459649 29/54 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.