DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and GBX1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens


Alignment Length:360 Identity:109/360 - (30%)
Similarity:140/360 - (38%) Gaps:88/360 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SFLMDSLLSDRPNLSQKKEKLGSPGGSP----TAAAAVAAAAMLPSIPMLPYPASYVG--SYLFS 62
            :|.:|||:...|..|......|.|...|    ....|:|.|.:...:|.|...||:.|  :..|.
Human    24 AFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQALAPAPLPAGLPPLAPLASFAGRLTNTFC 88

  Fly    63 LGIQQQQQQQ-----------------QQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYA 110
            .|:.|.....                 ...|:.|||||||||.||.....|......|.|  ...
Human    89 AGLGQAVPSMVALTTALPSFAEPPDAFYGPQELAAAAAAAAATAARNNPEPGGRRPEGGL--EAD 151

  Fly   111 QLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSS 175
            :|..::.|.:        .|.||          ||.|.....|     .||..|...:|......
Human   152 ELLPAREKVA--------EPPPP----------PPPHFSETFP-----SLPAEGKVYSSDEEKLE 193

  Fly   176 ASLDYTNNFDEPQGKRFKHESSCSPNSSP-LKNHSSGGP---------------------VEITP 218
            ||.      .:|.|...:.|.|...:... ..:.|:|||                     ..:|.
Human   194 ASA------GDPAGSEQEEEGSGGDSEDDGFLDSSAGGPGALLGPKPKLKGSLGTGAEEGAPVTA 252

  Fly   219 LINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK 283
            .:......|:|.||||||.||||||:||....|||...|.:||:.|:|||.||||||||||.|.|
Human   253 GVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWK 317

  Fly   284 --KGGSESPTFNLSTNSNGSPQASP--VSPQVKVH 314
              |.|      |:|:.| |.|..:|  |.| :.||
Human   318 RIKAG------NVSSRS-GEPVRNPKIVVP-IPVH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 34/167 (20%)
Homeobox 264..317 CDD:306543 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.