DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and gbx2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_694496.1 Gene:gbx2 / 245948 ZFINID:ZDB-GENE-020509-2 Length:342 Species:Danio rerio


Alignment Length:278 Identity:82/278 - (29%)
Similarity:105/278 - (37%) Gaps:110/278 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PSPPLSANPNSQQLPPIHNL---YGSPVVGGLPLPE------PGSFCTSPS------ASSSASLD 179
            |:.|.||.|.:....||..|   :.|.:..|:.|..      ||.|.:|||      |....|..
Zfish    64 PTLPQSALPTTHPHHPIPGLPSSFCSSLAQGMALTSTLMATLPGGFSSSPSQQHQDAARKLGSQS 128

  Fly   180 YTNNFDEPQ--------GKRFK----------HESSCSPNSSPLKNHS----------------- 209
            ....||:.|        ||.|.          |:|. |.::|.::.||                 
Zfish   129 IHAMFDKSQDIRLDGEDGKTFATKDSTSIPSFHDSQ-SVHTSTVRGHSKDDSKEDDCHRKDESFS 192

  Fly   210 --------------------------SGGPVEITPLIND------------YADSSKRIRTAFTS 236
                                      |||       ::|            ....::|.||||||
Zfish   193 MDSDLDYSSDDNGPGNAMCQKEDGDGSGG-------LDDGVHGGNGAGNTTSTGKNRRRRTAFTS 250

  Fly   237 TQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK---GGSESPTFNLSTNS 298
            .||||||:||....|||...|.:||:.|:|||.||||||||||.|.|:   |...|.|       
Zfish   251 EQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNVNSKT------- 308

  Fly   299 NGSPQASP--VSPQVKVH 314
             |.|..:|  |.| :.||
Zfish   309 -GEPSRNPKIVVP-IPVH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
gbx2NP_694496.1 Homeobox 244..297 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.