DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and GSX1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:354 Identity:108/354 - (30%)
Similarity:127/354 - (35%) Gaps:171/354 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSFLMDSLLSDRPNLSQKKEKLGSP---------------GGSPTAAAAVAAAAML------- 43
            |.||||:|||:  .....:||...|||               |.||.|..|..|..:.       
Human     1 MPRSFLVDSLV--LREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVT 63

  Fly    44 ----------PSIPML-----PYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAA------AAAAA 87
                      |::|:|     |:.:.|..:   .||           :||:|.:      .||||
Human    64 ASQLHGPPGPPALPLLKASFPPFGSQYCHA---PLG-----------RQHSAVSPGVAHGPAAAA 114

  Fly    88 AAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGS 152
            |||||                                |:..|                       
Human   115 AAAAL--------------------------------YQTSY----------------------- 124

  Fly   153 PVVGGLPLPEPGSF-CTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEI 216
                  |||:|..| |.|..:||                          |..|            
Human   125 ------PLPDPRQFHCISVDSSS--------------------------NQLP------------ 145

  Fly   217 TPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVK 281
                     ||||:||||||||||||||||:.|.|||||||||||..|.||||||||||||||||
Human   146 ---------SSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVK 201

  Fly   282 QKKGGSESPTFNLSTNSNGSPQASPVSPQ 310
            .||.|..|   |......|.......:||
Human   202 HKKEGKGS---NHRGGGGGGAGGGGSAPQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 45/51 (88%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20 9/20 (45%)
Homeobox 151..204 CDD:395001 45/52 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7182
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341872at2759
OrthoFinder 1 1.000 - - FOG0005158
OrthoInspector 1 1.000 - - otm40425
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.