DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and mab-5

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:285 Identity:77/285 - (27%)
Similarity:111/285 - (38%) Gaps:105/285 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MLPYPASYVG--SYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAA------ALQQHPHVSSSPGS 104
            |..|| .:.|  ||....|.....|........:|:::|||||||      .|..|.::::....
 Worm     1 MSMYP-GWTGDDSYWAGAGTTASSQSASSGTSASASSSAAAAAAANNLKTYELYNHTYMNNMKHM 64

  Fly   105 LYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTS 169
            |             ::|:.:.         |:||                           |..:
 Worm    65 L-------------AAGWMDN---------SSNP---------------------------FAYN 80

  Fly   170 PSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPL-----KNHSSGGPVEITPLINDYADSSKR 229
            |..::||      ||.|.:       :|....|.|:     ...:.||             .|||
 Worm    81 PLQATSA------NFGETR-------TSMPAISQPVFPWMKMGGAKGG-------------ESKR 119

  Fly   230 IRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK-----GGSES 289
            .|..::.:|.||||:||.::.||:|.||.||:..|.|:|:||||||||||:|.||     ||   
 Worm   120 TRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKEAKGEGG--- 181

  Fly   290 PTFNLSTNSNGSPQASPVSPQVKVH 314
                    ||.|.:.|....|.:.|
 Worm   182 --------SNESDEESNQDEQNEQH 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 29/51 (57%)
mab-5NP_498695.1 Homeobox 120..173 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.