DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and ceh-13

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans


Alignment Length:221 Identity:70/221 - (31%)
Similarity:96/221 - (43%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HPHVSSSPGSLYHPYAQLFASKRKSSGFSNY---EGCYPSPPLSANPNSQQLPPIHNLYGSPVVG 156
            :|.|.||...|.|..|.::|:..     |||   .| :.|||.:|:                   
 Worm    25 YPSVPSSYSPLNHHPADIWAAHP-----SNYIMGNG-HVSPPATAS------------------- 64

  Fly   157 GLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLIN 221
            ||..|      .|.|::|||.|.......:....::.|.......::|.|.              
 Worm    65 GLSPP------ASRSSNSSAELPTGVTASQHNTYKWMHTKRSQRPAAPKKK-------------- 109

  Fly   222 DYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGG 286
             ..|.:...||.||:.||.|||:||....|::|.||.|||:.|:|.|.||||||||||:|:||..
 Worm   110 -VIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKRE 173

  Fly   287 SESPTFNLSTNSNGSPQASPVSPQVK 312
            .|......:|..:.||.:|.....||
 Worm   174 KEKAFLARNTWESNSPTSSCSGEDVK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 27/45 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.