DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and GSX2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:378 Identity:107/378 - (28%)
Similarity:132/378 - (34%) Gaps:166/378 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRSFLMDSLL---SDRP----------------------------------------------- 15
            |||||.:|||:   :.||                                               
Human     1 MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCV 65

  Fly    16 --NLSQKKEKLGS----PGGSPTAAAAVAAAAMLPSIPMLPYP-ASYVGSYLFSLGI-------- 65
              :|...:..:|:    .|...|.|.....|....::|:|... :|..|...|...:        
Human    66 TSHLHSSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALPLLKGQFSSAPGDAQFCPRVNHAHHHHH 130

  Fly    66 --QQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGC 128
              |......|.||..:||||||||||||         :..:|.||.                   
Human   131 PPQHHHHHHQPQQPGSAAAAAAAAAAAA---------AAAALGHPQ------------------- 167

  Fly   129 YPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFK 193
                                 :.:||            ||:.          |.|..:|  :||.
Human   168 ---------------------HHAPV------------CTAT----------TYNVADP--RRFH 187

  Fly   194 HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRI 258
            ..:....::|.:.|                   .||:|||||||||||||||||.|.||||||||
Human   188 CLTMGGSDASQVPN-------------------GKRMRTAFTSTQLLELEREFSSNMYLSRLRRI 233

  Fly   259 EIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNGSPQASPVSPQV 311
            |||..|.||||||||||||||||.||.|.       .|..|.......|..||
Human   234 EIATYLNLSEKQVKIWFQNRRVKHKKEGK-------GTQRNSHAGCKCVGSQV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 46/51 (90%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 8/34 (24%)
Homeobox 206..258 CDD:306543 46/51 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7182
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341872at2759
OrthoFinder 1 1.000 - - FOG0005158
OrthoInspector 1 1.000 - - otm40425
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.