DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Lbx2

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:207 Identity:61/207 - (29%)
Similarity:84/207 - (40%) Gaps:38/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 NPNSQQLPP--IHNLYGSPVVGGLP----LPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHE 195
            |...|:..|  |.::.|..:|...|    |||.|....||..:          .:|...|.|...
Mouse     2 NSVHQRRTPFSIADILGPSMVPEAPSAPQLPEAGPDPASPLCA----------LEELASKTFLGH 56

  Fly   196 SSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEI 260
               ||.::|..:.....| |..|.........::.|||||:.|:|||||.|....||:...|..:
Mouse    57 ---SPRATPQPSEGRAAP-EAPPGPGAGVRRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGL 117

  Fly   261 ANRLRLSEKQVKIWFQNRRVKQKKGGSE-----------SP---TFNLSTNSNGSPQASP----V 307
            |.||.|:..||..||||||.|.|:...|           ||   .:....:|..||...|    .
Mouse   118 AARLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLCGLSPGVLCYPALPDSTSSPDPGPSGPDS 182

  Fly   308 SPQVKVHELKVE 319
            .|.:...|::|:
Mouse   183 EPNLSDEEIQVD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 28/55 (51%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 22/100 (22%)
Homeodomain 85..141 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195 7/31 (23%)

Return to query results.
Submit another query.