DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxd4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:248 Identity:81/248 - (32%)
Similarity:107/248 - (43%) Gaps:67/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GSLYHPYAQLFASKRKSSGFSNYEGCYPSP-------------PLSANP---NSQQLPPIHNLYG 151
            |.|....|..:.|..:.:.|.. .|.||.|             |.||.|   :.|:.....:.||
Mouse    27 GYLGEQGADYYGSGAQGADFQP-SGLYPRPDFGEQPFGGGGPGPGSALPARGHGQEPSGPGSHYG 90

  Fly   152 SP---VVGGLPLPEPGS-FCTSPSASSSASLDYTNNFDEPQGKRFK------------HESSCSP 200
            :|   .....|.|.||: .|:.|          |.....|.|...|            |.:|.:|
Mouse    91 APGERCPAPPPAPLPGARACSQP----------TGPKQPPPGTALKQPAVVYPWMKKVHVNSVNP 145

  Fly   201 NSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLR 265
                  |::.|.|              ||.|||:|..|:||||:||..|.||:|.||||||:.|.
Mouse   146 ------NYTGGEP--------------KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLC 190

  Fly   266 LSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNG-SPQASP---VSPQVKVH 314
            |||:|:||||||||:|.||......|...|::|:. |..|:|   :.|..|.|
Mouse   191 LSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSCSSSAAPGQHLQPMAKDH 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 24/105 (23%)
Antp-type hexapeptide 131..136 0/4 (0%)
Homeobox 155..208 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.