DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxd3

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:281 Identity:93/281 - (33%)
Similarity:127/281 - (45%) Gaps:69/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GSYLFSLGIQQQQQQQQQQQQHAAAAAAA-----AAAAAALQQHPHVSSSP-GSLYHPYAQLFAS 115
            |.|.:|............|.....|||.:     .::|.::|     ||:| .:..|..|:|..|
Mouse    30 GGYGYSKATDTYGYSTPHQPYPPPAAANSLDSDYPSSACSIQ-----SSAPLRAPAHKGAELNGS 89

  Fly   116 -KRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPE----PGSFCTSP----- 170
             .|..:|.|...|....||   ..||:|.||      .|     |.|.    |.|..|:|     
Mouse    90 CMRPGTGNSQGGGGGNQPP---GLNSEQQPP------QP-----PPPPPPTLPPSSPTNPGSGVP 140

  Fly   171 --------SASSSASLDYTNNFD--EPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYAD 225
                    |||||:|......|.  :...:..|.::||:.:....::.|..||            
Mouse   141 AKKTKGGLSASSSSSTISKQIFPWMKESRQNSKQKNSCATSGENCEDKSPPGP------------ 193

  Fly   226 SSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK-----KG 285
            :|||:|||:||.||:|||:||..|.||.|.||:|:||.|.|:|:|:||||||||:|.|     ||
Mouse   194 ASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKG 258

  Fly   286 GSESPTFNLSTNSNGSPQASP 306
            ...||       :..||:.||
Mouse   259 ILHSP-------AGQSPERSP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 46/184 (25%)
Antp-type hexapeptide 161..166 1/4 (25%)
Homeobox 199..251 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 7/22 (32%)
DUF4074 370..431 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.