DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxd1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:341 Identity:95/341 - (27%)
Similarity:132/341 - (38%) Gaps:95/341 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPM------LPYPAS--YV-----GSYLFSLGI 65
            ||...|....|||..|:..:...:|.|...||.|.      :|.||:  |.     |:|      
Mouse    36 RPVALQPAFPLGSGDGAFVSCLPLATARPTPSPPAGPAQSPVPQPAAPRYAPCTLEGAY------ 94

  Fly    66 QQQQQQQQQQQQHAAAAAAA---------------AAAAAALQQHPHVSSSPGSLYHPYAQLFAS 115
                      ::.||.|:||               |...||.:...||..:..:::........|
Mouse    95 ----------ERGAAPASAAEYGFLGSGPAFDFPGALGRAADEGGAHVHYATSAVFSGGGSFLLS 149

  Fly   116 KRKSSGFSNYEGCYPS---PPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSAS 177
            .:.........|.:|:   .|...:|.     |...:  ||..|..|.|      .||::|..|:
Mouse   150 GQVDFAAFGEPGPFPACLKEPADGHPG-----PFQTV--SPAPGACPKP------ASPTSSLPAA 201

  Fly   178 LDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLEL 242
               .:.|:..:.||      .:|..|.|..:.:..|             ...|||.|::.||.||
Mouse   202 ---HSTFEWMKVKR------NAPKKSKLSEYGATSP-------------PSAIRTNFSTKQLTEL 244

  Fly   243 EREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSES-------------PTFNL 294
            |:||..|.||:|.|||||||.|:|::.||||||||||:||||...|.             |....
Mouse   245 EKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASIKLPRSET 309

  Fly   295 STNSNGSPQASPVSPQ 310
            |...:|....||...|
Mouse   310 SPIKSGRNLGSPSQAQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 15/61 (25%)
Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.