DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxc6

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_006520531.1 Gene:Hoxc6 / 15425 MGIID:96197 Length:243 Species:Mus musculus


Alignment Length:213 Identity:63/213 - (29%)
Similarity:90/213 - (42%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSAS 173
            |:..|.|.:::..||:..|.|   ...:|...|:...:.|                  |...:..
Mouse    50 YSTPFYSPQENVVFSSSRGPY---DYGSNSFYQEKDMLSN------------------CRQNTLG 93

  Fly   174 SSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITP--LINDYADSSKRIRTAFTS 236
            .:.......:|...||:....:...|....|.....:...|...|  |...|....:|.|..::.
Mouse    94 HNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSVCFVPGSLGVGYGADRRRGRQIYSR 158

  Fly   237 TQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNGS 301
            .|.||||:||..|.||:|.|||||||.|.|:|:|:||||||||:|.||  ..:.|..||....|:
Mouse   159 YQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK--ESNLTSTLSGGGGGA 221

  Fly   302 PQASPVSPQVKVHELKVE 319
            ...|....:.|..|.:.|
Mouse   222 TADSLGGKEEKREETEEE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
Hoxc6XP_006520531.1 Homeobox 153..206 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.