DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxc5

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:207 Identity:66/207 - (31%)
Similarity:90/207 - (43%) Gaps:58/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ANPNSQQLP--PIHNL-----YGSP--------VVGGL--------PLP-----------EPGSF 166
            ||...:|.|  |.:|:     |||.        ..|||        |.|           .|.:.
Mouse     6 ANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAH 70

  Fly   167 CTSPSASSSASLDYTNNFDE--PQGKRFKHESSCSP-------NSSPLKNH--SSGGPVEI---- 216
            ...|:.|::|:..:....||  |.......:.:..|       :|..:|..  .:|.|..:    
Mouse    71 PDRPACSAAAAPGHALGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPP 135

  Fly   217 ---------TPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVK 272
                     |.|...:....||.||::|..|.||||:||..|.||:|.|||||||.|.|:|:|:|
Mouse   136 APPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIK 200

  Fly   273 IWFQNRRVKQKK 284
            |||||||:|.||
Mouse   201 IWFQNRRMKWKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 12/76 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 11/72 (15%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeobox 158..212 CDD:395001 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.