DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxc5

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:207 Identity:66/207 - (31%)
Similarity:90/207 - (43%) Gaps:58/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ANPNSQQLP--PIHNL-----YGSP--------VVGGL--------PLP-----------EPGSF 166
            ||...:|.|  |.:|:     |||.        ..|||        |.|           .|.:.
Mouse     6 ANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAH 70

  Fly   167 CTSPSASSSASLDYTNNFDE--PQGKRFKHESSCSP-------NSSPLKNH--SSGGPVEI---- 216
            ...|:.|::|:..:....||  |.......:.:..|       :|..:|..  .:|.|..:    
Mouse    71 PDRPACSAAAAPGHALGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPP 135

  Fly   217 ---------TPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVK 272
                     |.|...:....||.||::|..|.||||:||..|.||:|.|||||||.|.|:|:|:|
Mouse   136 APPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIK 200

  Fly   273 IWFQNRRVKQKK 284
            |||||||:|.||
Mouse   201 IWFQNRRMKWKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 36/55 (65%)
Hoxc5NP_783857.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 11/72 (15%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeodomain 156..212 CDD:459649 36/55 (65%)

Return to query results.
Submit another query.