DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxc4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus


Alignment Length:260 Identity:79/260 - (30%)
Similarity:112/260 - (43%) Gaps:77/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SPGSLYHPYAQLFASKRKSSGFS-NYEGCYPSPP--------------LSANPNSQQLPPI---- 146
            |..|....::..:..:.:.|||. :::..||.||              |....||:...|.    
Mouse    24 SQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRAHGPAQAGH 88

  Fly   147 -HNLYGSPVVGGLPL------PEPG-SFCTSP------SASSSASLDYTNNFDEPQGKRFKHESS 197
             |.....|:....||      |.|. ..|:.|      ||:|...:.|      |..|:. |.|:
Mouse    89 HHPEKSQPLCEPAPLSGTSASPSPAPPACSQPAPDHPSSAASKQPIVY------PWMKKI-HVST 146

  Fly   198 CSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIAN 262
            .:|      |::.|.|              ||.|||:|..|:||||:||.:|.||:|.||||||:
Mouse   147 VNP------NYNGGEP--------------KRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAH 191

  Fly   263 RLRLSEKQVKIWFQNRRVKQKK--------------GGSESPTFNLS---TNSNGSPQASPVSPQ 310
            .|.|||:|:||||||||:|.||              .|:...|.:.:   |:.:.|..|:|...|
Mouse   192 SLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQ 256

  Fly   311  310
            Mouse   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 23/105 (22%)
Antp-type hexapeptide 135..140 2/10 (20%)
Homeobox 159..213 CDD:365835 35/53 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.