DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa7

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus


Alignment Length:245 Identity:75/245 - (30%)
Similarity:108/245 - (44%) Gaps:55/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQ-------------LPPIHN----LYG 151
            |.|:..| ||:  :.::|.|.::...|: ..|..||||:             :|.::|    ||.
Mouse     3 SSYYVNA-LFS--KYTAGASLFQNAEPT-SCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSPLYQ 63

  Fly   152 SPVVGGLPLPEPGSFCTSPSASSSASLDYTNNF-----DEPQGKRFKHESSCSPNSSPLKNHSSG 211
            ||...|..|        ...|.:.....|..|.     |..:|       :|......:.:    
Mouse    64 SPFASGYGL--------GADAYNLPCASYDQNIPGLCSDLAKG-------ACDKADEGVLH---- 109

  Fly   212 GPVE----ITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVK 272
            ||.|    |.|.:.......||.|..:|..|.||||:||..|.||:|.||||||:.|.|:|:|:|
Mouse   110 GPAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 174

  Fly   273 IWFQNRRVKQK---KGGSESPTFNLSTNSNGSPQASPVSPQVKVHELKVE 319
            |||||||:|.|   |..|::||   :...:..|..|..:.:....|.:.|
Mouse   175 IWFQNRRMKWKKEHKDESQAPT---AAPEDAVPSVSTAADKADEEEEEEE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 32/51 (63%)
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 2/4 (50%)
Homeobox 133..185 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.