DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa5

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus


Alignment Length:224 Identity:70/224 - (31%)
Similarity:95/224 - (42%) Gaps:63/224 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FASKRKSSGFSNYEGCYPSPPLSANP-NSQQLPPIHNLYGSPVVGGLPLPEPG---------SFC 167
            |.|..::..::......|:.|..:.| .|...||...|..|.|.     |.||         |..
Mouse    64 FGSGERARSYAAGASAAPAEPRYSQPATSTHSPPPDPLPCSAVA-----PSPGSDSHHGGKNSLG 123

  Fly   168 TSPSASSSASLDYTNN-----------FDEPQGKR---FKHESSCSPNSSP----------LKNH 208
            .|..||::|...:.::           .|.|....   .:.|.|.:|.:.|          :.:.
Mouse   124 NSSGASANAGSTHISSREGVGTASAAEEDAPASSEQAGAQSEPSPAPPAQPQIYPWMRKLHISHD 188

  Fly   209 SSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKI 273
            :.|||            ..||.|||:|..|.||||:||..|.||:|.||||||:.|.|||:|:||
Mouse   189 NIGGP------------EGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI 241

  Fly   274 WFQNRRVKQKK------------GGSESP 290
            ||||||:|.||            ||:..|
Mouse   242 WFQNRRMKWKKDNKLKSMSMAAAGGAFRP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 22/104 (21%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 199..252 CDD:333795 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.