DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa3

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034582.1 Gene:Hoxa3 / 15400 MGIID:96175 Length:443 Species:Mus musculus


Alignment Length:267 Identity:88/267 - (32%)
Similarity:114/267 - (42%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AAAAAAAALQQHPHVSS----SPGSLYHPYAQLFASKRKSSGFSN----YEGCY------PS-PP 133
            ||...|....|.|:..|    :.|..||..|....|...:.|...    .|.|.      || ||
Mouse    20 AANGFAYNASQQPYAPSAALGTDGVEYHRPACSLQSPASAGGHPKTHELSEACLRTLSGPPSQPP 84

  Fly   134 LSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSC 198
            ....|   .|||      .|.....|.|:|......|.|.:.|:....::...||... .:.:..
Mouse    85 GLGEP---PLPP------PPPQAAPPAPQPPQPPPQPPAPTPAAPPPPSSVSPPQSAN-SNPTPA 139

  Fly   199 SPNSSPLKNHSSGGPVEITPLINDYAD-------------------------SSKRIRTAFTSTQ 238
            |...|||.|..:.|. :|.|.:.:...                         ||||.|||:||.|
Mouse   140 STAKSPLLNSPTVGK-QIFPWMKESRQNTKQKTSGSSSGESCAGDKSPPGQASSKRARTAYTSAQ 203

  Fly   239 LLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNG-SP 302
            |:|||:||..|.||.|.||:|:||.|.|:|:|:||||||||:|.||   :.....:.|:|.| ||
Mouse   204 LVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKK---DQKGKGMLTSSGGQSP 265

  Fly   303 QASPVSP 309
            ..|||.|
Mouse   266 SRSPVPP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
Hoxa3NP_034582.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..151 22/86 (26%)
Antp-type hexapeptide 156..161 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..197 4/33 (12%)
COG5576 <182..309 CDD:227863 49/94 (52%)
Homeobox 196..249 CDD:365835 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..354 11/28 (39%)
DUF4074 378..441 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.