Sequence 1: | NP_996087.2 | Gene: | ind / 2768974 | FlyBaseID: | FBgn0025776 | Length: | 320 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034581.1 | Gene: | Hoxa2 / 15399 | MGIID: | 96174 | Length: | 372 | Species: | Mus musculus |
Alignment Length: | 277 | Identity: | 78/277 - (28%) |
---|---|---|---|
Similarity: | 108/277 - (38%) | Gaps: | 81/277 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 VSSSPG-----SLYHPYAQLFASKRKSSGFSNYEGCYPSPPL-----SANPNSQQLPPIHNLYGS 152
Fly 153 PVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSG----GP 213
Fly 214 VEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNR 278
Fly 279 RVKQKK-------GGSESPTFNLSTNS-------------------------------------- 298
Fly 299 ------NGSPQASPVSP 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ind | NP_996087.2 | Homeobox | 231..283 | CDD:278475 | 35/51 (69%) |
Hoxa2 | NP_034581.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 48..95 | 16/62 (26%) | |
Antp-type hexapeptide | 96..101 | 0/4 (0%) | |||
Homeobox | 143..195 | CDD:278475 | 35/51 (69%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..225 | 5/30 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |