DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus


Alignment Length:277 Identity:78/277 - (28%)
Similarity:108/277 - (38%) Gaps:81/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VSSSPG-----SLYHPYAQLFASKRKSSGFSNYEGCYPSPPL-----SANPNSQQLPPIHNLYGS 152
            ::|.|.     :.:.|.|..|.|....:...::....| ||.     |.||.|      |..:|:
Mouse    12 INSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIP-PPFEQTIPSLNPGS------HPRHGA 69

  Fly   153 PVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSG----GP 213
            . |||.|...|.....||..:.:        ...|:....|.:.:....:.|....|:|    |.
Mouse    70 G-VGGRPKSSPAGSRGSPVPAGA--------LQPPEYPWMKEKKAAKKTALPPAAASTGPACLGH 125

  Fly   214 VEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNR 278
            .|...:.:.....|:|:|||:|:|||||||:||..|.||.|.||:|||..|.|:|:|||:|||||
Mouse   126 KESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNR 190

  Fly   279 RVKQKK-------GGSESPTFNLSTNS-------------------------------------- 298
            |:|.|:       ..||....||..:.                                      
Mouse   191 RMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQ 255

  Fly   299 ------NGSPQASPVSP 309
                  ||..|..||||
Mouse   256 QAPNGHNGDSQTFPVSP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95 16/62 (26%)
Antp-type hexapeptide 96..101 0/4 (0%)
Homeobox 143..195 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.