DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034579.3 Gene:Hoxa1 / 15394 MGIID:96170 Length:336 Species:Mus musculus


Alignment Length:287 Identity:82/287 - (28%)
Similarity:114/287 - (39%) Gaps:80/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PSIPMLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPH-------VSSS 101
            ||.....:.|.| |.|    |:.|:..........|.|..:...:...:|.|.|       ...|
Mouse    98 PSYGAQNFSAPY-GPY----GLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGS 157

  Fly   102 PGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSF 166
            |..::|.|.|    ::::...:.|              :..|.|:|..:...             
Mouse   158 PQYIHHSYGQ----EQQTLALATY--------------NNSLSPLHASHQEA------------- 191

  Fly   167 CTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIR 231
            |.||::.:|:.   ...||..:.||           :|.|....|.        ..|......:|
Mouse   192 CRSPASETSSP---AQTFDWMKVKR-----------NPPKTGKVGE--------YGYVGQPNAVR 234

  Fly   232 TAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK------------ 284
            |.||:.||.|||:||..|.||:|.||:|||..|:|:|.||||||||||:||||            
Mouse   235 TNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPA 299

  Fly   285 --GGSESPTFNLSTNSNGSPQA-SPVS 308
              .||:..|...|..|:.||.| ||.|
Mouse   300 TPPGSDEKTEESSEKSSPSPSAPSPAS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
Hoxa1NP_034579.3 COG5576 177..>287 CDD:227863 51/158 (32%)
Homeobox 234..287 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.