DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Dlx5

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:220 Identity:59/220 - (26%)
Similarity:90/220 - (40%) Gaps:44/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NYEGCYPSPPLSANPNSQQLPPI------HNLYGSPVVGGLPLPEPGSFCTSPSASSSASLD-YT 181
            :::..:|:.....:| ||:.|.:      .:.|.||....     |..:|:..|||...:|: |.
Mouse    16 DFQAPFPTSAAMHHP-SQESPTLPESSATDSDYYSPAGAA-----PHGYCSPTSASYGKALNPYQ 74

  Fly   182 NNFDEPQG-------KRFKHESSCSPNSSPLKNHSSGGPVEITP----------------LINDY 223
            ..:....|       |.:......||      .|..||.....|                ::|..
Mouse    75 YQYHGVNGSAAGYPAKAYADYGYASP------YHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGK 133

  Fly   224 ADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK--GG 286
            ....::.||.::|.||..|:|.|....||:...|.|:|..|.|::.||||||||:|.|.||  ..
Mouse   134 PKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKN 198

  Fly   287 SESPTFNLSTNSNGSPQASPVSPQV 311
            .|.|..:..::|:.....||.||.|
Mouse   199 GEMPPEHSPSSSDPMACNSPQSPAV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 25/55 (45%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 6/33 (18%)
DLL_N 32..118 CDD:463567 20/96 (21%)
Homeodomain 138..194 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.