DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and LBX1

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_006553.2 Gene:LBX1 / 10660 HGNCID:16960 Length:281 Species:Homo sapiens


Alignment Length:183 Identity:54/183 - (29%)
Similarity:71/183 - (38%) Gaps:55/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PPLSANPNSQQLP-PIHNLYGSPVV---------------------GGLPLPEPGSFCTSPSASS 174
            ||  ||.|....| .|.::...|.|                     |||||            :.
Human    25 PP--ANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPL------------AG 75

  Fly   175 SASLDYTN---NFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEI-----TPLINDYADSSKRIR 231
            .|.|..|:   ..:|...|.||     ....|.|:.......:.|     ||      ...::.|
Human    76 RALLSQTSPLCALEELASKTFK-----GLEVSVLQAAEGRDGMTIFGQRQTP------KKRRKSR 129

  Fly   232 TAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK 284
            ||||:.|:.|||:.|.:..|||...|.:||.:|.|:..||..||||||.|.|:
Human   130 TAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 27/55 (49%)
LBX1NP_006553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 5/11 (45%)
Homeodomain 126..182 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.