Sequence 1: | NP_996087.2 | Gene: | ind / 2768974 | FlyBaseID: | FBgn0025776 | Length: | 320 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598793.2 | Gene: | Hoxb2 / 103889 | MGIID: | 96183 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 67/200 - (33%) |
---|---|---|---|
Similarity: | 95/200 - (47%) | Gaps: | 33/200 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 144 PPIHNLYGSPVVGGLPLPEPGS---------------FCTSPSASSSASLDYTNNFDEPQGKRFK 193
Fly 194 HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRI 258
Fly 259 EIANRLRLSEKQVKIWFQNRRVKQKK---------GGSESPTFNLSTNSNGSPQASP-VSP-QVK 312
Fly 313 VHELK 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ind | NP_996087.2 | Homeobox | 231..283 | CDD:278475 | 35/51 (69%) |
Hoxb2 | NP_598793.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 39..143 | 19/99 (19%) | |
Antp-type hexapeptide | 92..97 | 0/4 (0%) | |||
Homeobox | 145..197 | CDD:278475 | 35/51 (69%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..231 | 10/40 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 246..295 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |