DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxb2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:200 Identity:67/200 - (33%)
Similarity:95/200 - (47%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PPIHNLYGSPVVGGLPLPEPGS---------------FCTSPSASSSASLDYTNNFDEPQGKRFK 193
            ||:...:.|..:|...|..|||               ...:|.|.....:....:..:|.    :
Mouse    47 PPLEQTFPSLQLGASTLQRPGSQKQAGDGPALRSPPPLPVAPPAPEFPWMKEKKSTKKPS----Q 107

  Fly   194 HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRI 258
            ..:|.||.:|.::....|.|.:...|.......|:|:|||:|:|||||||:||..|.||.|.||:
Mouse   108 SAASPSPAASSVRASEVGSPSDGPGLPECGGSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRV 172

  Fly   259 EIANRLRLSEKQVKIWFQNRRVKQKK---------GGSESPTFNLSTNSNGSPQASP-VSP-QVK 312
            |||..|.|:|:|||:||||||:|.|:         |....|:   :.:..|.|...| ||| .|.
Mouse   173 EIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPEGEPGGPS---AQDDAGEPAEEPTVSPGDVA 234

  Fly   313 VHELK 317
            .|.|:
Mouse   235 THRLR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 19/99 (19%)
Antp-type hexapeptide 92..97 0/4 (0%)
Homeobox 145..197 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.