DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxb2

DIOPT Version :10

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:200 Identity:67/200 - (33%)
Similarity:95/200 - (47%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PPIHNLYGSPVVGGLPLPEPGS---------------FCTSPSASSSASLDYTNNFDEPQGKRFK 193
            ||:...:.|..:|...|..|||               ...:|.|.....:....:..:|.    :
Mouse    47 PPLEQTFPSLQLGASTLQRPGSQKQAGDGPALRSPPPLPVAPPAPEFPWMKEKKSTKKPS----Q 107

  Fly   194 HESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRI 258
            ..:|.||.:|.::....|.|.:...|.......|:|:|||:|:|||||||:||..|.||.|.||:
Mouse   108 SAASPSPAASSVRASEVGSPSDGPGLPECGGSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRV 172

  Fly   259 EIANRLRLSEKQVKIWFQNRRVKQKK---------GGSESPTFNLSTNSNGSPQASP-VSP-QVK 312
            |||..|.|:|:|||:||||||:|.|:         |....|:   :.:..|.|...| ||| .|.
Mouse   173 EIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPEGEPGGPS---AQDDAGEPAEEPTVSPGDVA 234

  Fly   313 VHELK 317
            .|.|:
Mouse   235 THRLR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeodomain 228..284 CDD:459649 36/55 (65%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 19/99 (19%)
Antp-type hexapeptide 92..97 0/4 (0%)
Homeodomain 142..198 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.