DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxa4

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:311 Identity:94/311 - (30%)
Similarity:117/311 - (37%) Gaps:82/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GSPGGSPTAAAAVAAAAMLPSIPMLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAA 89
            |.|||...............|.|.||.|                       ..|||....|..|.
  Rat    27 GGPGGGDGGVGGGPGYPRPQSSPHLPAP-----------------------NPHAARQTPAYYAP 68

  Fly    90 AALQQHPHVSSSPGSLYH------PYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHN 148
            .|.:...|     |.||.      |||...||..:..         .||...|:|:....||   
  Rat    69 RAREPSYH-----GGLYPAPAAACPYACRGASPARPE---------QSPAPGAHPSPAPQPP--- 116

  Fly   149 LYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGK--------RFKHESSCSPNSSPL 205
               :|.....|.|...:..|..||.:...|........|:||        :..|.|:.:|     
  Rat   117 ---APPRRCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNP----- 173

  Fly   206 KNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQ 270
             :::.|.|              ||.|||:|..|:||||:||..|.||:|.||||||:.|.|||:|
  Rat   174 -SYNGGEP--------------KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQ 223

  Fly   271 VKIWFQNRRVKQKKGGSESPTFNLSTNSNGSPQASP-----VSPQVKVHEL 316
            |||||||||:|.||......|...|:|...:|...|     .||....|.|
  Rat   224 VKIWFQNRRMKWKKDHKLPNTKMRSSNPASAPAGPPGKAQTHSPHPHPHPL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 36/51 (71%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.