DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and mnx1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_002935225.2 Gene:mnx1 / 100496534 XenbaseID:XB-GENE-919890 Length:338 Species:Xenopus tropicalis


Alignment Length:308 Identity:83/308 - (26%)
Similarity:118/308 - (38%) Gaps:102/308 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRSFLMDSLLSDRPNLSQ----------KKEKLGSPGGSPTAAAAVAAAAMLPSIP----MLPYP 52
            |::|.:|:||:..|..||          ....| |..|||.:....:.....||.|    ::|.|
 Frog     4 SKNFRIDALLAIDPPKSQTSPLALVTSLSSSSL-SNSGSPPSEHTDSLRTDTPSPPRTCGLVPKP 67

  Fly    53 ASYVGSYLFSL-----------GIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLY 106
             .::.|:...:           ||..|.........::||||.||.      |||       :|.
 Frog    68 -GFLSSHQHPINMMALHPQAAPGIPPQALYGHPMYSYSAAAALAAG------QHP-------ALS 118

  Fly   107 HPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPS 171
            :||.|:..:         :...:|..|:..:..:.||    :.:......|:.||:...|     
 Frog   119 YPYPQMQGA---------HHAHHPVDPIKISAGTFQL----DQWLRASTAGMMLPKMADF----- 165

  Fly   172 ASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTS 236
                                         ||....|               .....:|.||||||
 Frog   166 -----------------------------NSQAQSN---------------LLGKCRRPRTAFTS 186

  Fly   237 TQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK 284
            .||||||.:|..|.||||.:|.|:|..|.|:|.||||||||||:|.|:
 Frog   187 QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
mnx1XP_002935225.2 Homeobox 180..234 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.