DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxb1

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_004918719.1 Gene:hoxb1 / 100493290 XenbaseID:XB-GENE-485772 Length:304 Species:Xenopus tropicalis


Alignment Length:237 Identity:76/237 - (32%)
Similarity:108/237 - (45%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YPSPPLSANPNSQQLPPI----------HNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNN 183
            ||..|.:..|.:..|...          |..|.||...|:...:. ::|::..|:|::   |::.
 Frog    72 YPPQPSAGVPYTNSLTSYTPQTCNQAYGHQAYASPDADGIYFQQT-AYCSNTGANSNS---YSDG 132

  Fly   184 F-----------DEPQGKRFK-------------HES---SCSPNSSPLKNHS------SGGPVE 215
            :           ..|.|:..:             ||.   || |:...|.||:      ...|.:
 Frog   133 YCGAVPGPAQYQQHPYGQEHQGLLQAYHNPPSMLHEEKEPSC-PSEQALPNHTFDWMKVKRNPPK 196

  Fly   216 ITPLINDYADSSKR--IRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNR 278
            .|....|:..|:::  |||.||:.||.|||:||..|.||:|.||:|||..|.|:|.|||||||||
 Frog   197 TTAKPVDFGLSTQQNTIRTNFTTKQLTELEKEFHFNKYLTRARRVEIAATLELNETQVKIWFQNR 261

  Fly   279 RVKQKK-----------GGSESPTFNLS-TNSNGSPQASPVS 308
            |:||||           .||......:| .:|:.||.|||.|
 Frog   262 RMKQKKREREGLAPSAIKGSMKENGEMSDLSSSTSPDASPNS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 34/51 (67%)
hoxb1XP_004918719.1 PTZ00395 <12..>147 CDD:185594 14/78 (18%)
Homeobox 214..267 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.