DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and Hoxb2

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:218 Identity:71/218 - (32%)
Similarity:98/218 - (44%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGS---------------FCTSPSASSSASLD 179
            |.||          ||:...:.|..:|...|..|||               ...:|.|.....:.
  Rat    44 PPPP----------PPLEQTFPSLQLGASTLQRPGSQKPAGDGPALRPPPPLPVAPPAPEFPWMK 98

  Fly   180 YTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELER 244
            ...:..:|.    :..::.||.:|.::....|.|.:...|.......|:|:|||:|:|||||||:
  Rat    99 EKKSAKKPS----QSAATPSPAASSVRASGVGSPSDGPGLPESGGSGSRRLRTAYTNTQLLELEK 159

  Fly   245 EFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKK------------GGSESPTFNLSTN 297
            ||..|.||.|.||:|||..|.|:|:|||:||||||:|.|:            ||       ||..
  Rat   160 EFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPDGEPGG-------LSAQ 217

  Fly   298 SN-GSPQASP-VSP-QVKVHELK 317
            .: |.|...| ||| .|..|.|:
  Rat   218 DDAGEPAEEPTVSPGDVASHRLR 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 35/51 (69%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.