DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ind and hoxc3

DIOPT Version :9

Sequence 1:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:254 Identity:82/254 - (32%)
Similarity:112/254 - (44%) Gaps:58/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PGSLYHPYAQLFASKRKSSGFSNYEGC-------YPS-----PPLSANPNSQQLPPIHNLYGSPV 154
            |.||::..:..|.    ..||....|.       |||     ||....|::......|.  |...
 Frog     4 PKSLFYDNSASFG----GCGFQGNNGMGYLGQQDYPSEDDYQPPFCLPPDTANGSASHK--GEHS 62

  Fly   155 VGGL---------------------PLPEPGS--FCTSPSASSSASLDYTNNFDEPQGKR----- 191
            :.|:                     |||:..|  .|||..::...|.|.|:...:.:|..     
 Frog    63 IKGIDFHLSEVSEQAQQPKSPNSDSPLPKSASTQSCTSKKSTGPVSSDVTSPNKKSKGSNMPKQI 127

  Fly   192 FKHESSCSPNSSPLKNHSSGGPVEITPLIND--YADSSKRIRTAFTSTQLLELEREFSHNAYLSR 254
            |........||...|  .:..|.:..|.::.  .:.:|||.|||:|::||:|||:||..|.||.|
 Frog   128 FPWMKETRQNSKQKK--QAPPPADDAPAVDSSFLSSASKRARTAYTNSQLVELEKEFHFNRYLCR 190

  Fly   255 LRRIEIANRLRLSEKQVKIWFQNRRVKQK-----KGGSESPTFNLSTNSNGSPQASPVS 308
            .||:|:|..|.|||:|:||||||||:|.|     |||..||. .||.:|  ||...|.|
 Frog   191 PRRLEMAKLLNLSERQIKIWFQNRRMKFKKDHKGKGGGGSPG-GLSPSS--SPSLMPYS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 33/51 (65%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 33/52 (63%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.