DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn12R and RPN12b

DIOPT Version :9

Sequence 1:NP_996086.1 Gene:Rpn12R / 2768973 FlyBaseID:FBgn0036465 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_199019.2 Gene:RPN12b / 834209 AraportID:AT5G42040 Length:233 Species:Arabidopsis thaliana


Alignment Length:248 Identity:74/248 - (29%)
Similarity:114/248 - (45%) Gaps:55/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QLIKSREMLEIAVEHSITIKDYAAFERYMAQLNTYYYDYDKYLES-------------------- 96
            ||::..:..| ..:.:..|||:......::||..    :|.||.|                    
plant     4 QLMEVSQQFE-RFKAAFIIKDFDTCSSLLSQLKL----FDHYLISLSLNALLLLTCALFFLCTRN 63

  Fly    97 ----SKHMYKFMGLNLLYMLATNRLADFHIELERLPTALLLHDSFIQPVLALENYYMEGRYNKIL 157
                |......||||||.:|..||:|:||.||..|.:| .|.:..|:..:.||..:|||.||::|
plant    64 RIPPSPQENLIMGLNLLRLLVQNRIAEFHTELGLLSSA-TLENPCIKHAVELEQSFMEGAYNRVL 127

  Fly   158 QAKKSMPSEIYSNFMDILVNTAREEIASCMEKSYLKMAPKLAAQRLGLRPGSKELF-----ELAT 217
            .|:::.|.|.|..|||:|..|.|:|||.|.||:|         ..|.:..|.|.|.     :|.|
plant   128 SARQTAPDETYVYFMDLLAKTIRDEIAGCSEKAY---------DHLSISEGCKMLLFSSDQQLLT 183

  Fly   218 KRQWCLDEEGNYDYA-GL-------HTRPMEKVPAKDIATHNLTYAQELEKIV 262
               :..:|...::.. ||       .|.|.:::|:..:....|:|.:|||:|:
plant   184 ---YVNEEHPEWEVKDGLVVFQKTRETAPCKEIPSLQLINQTLSYTRELERIL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn12RNP_996086.1 CSN8_PSD8_EIF3K 98..228 CDD:287089 50/134 (37%)
RPN12bNP_199019.2 CSN8_PSD8_EIF3K 73..201 CDD:287089 52/140 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2255
eggNOG 1 0.900 - - E1_KOG3151
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I1510
OMA 1 1.010 - - QHG53806
OrthoDB 1 1.010 - - D1183195at2759
OrthoFinder 1 1.000 - - FOG0003512
OrthoInspector 1 1.000 - - mtm1162
orthoMCL 1 0.900 - - OOG6_102164
Panther 1 1.100 - - O PTHR12387
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.