DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn12R and Psmd8

DIOPT Version :9

Sequence 1:NP_996086.1 Gene:Rpn12R / 2768973 FlyBaseID:FBgn0036465 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_080821.3 Gene:Psmd8 / 57296 MGIID:1888669 Length:353 Species:Mus musculus


Alignment Length:262 Identity:108/262 - (41%)
Similarity:166/262 - (63%) Gaps:4/262 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNLYTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQKDQLIKSREMLEIAVEH 66
            :.:|.:||:||::..|||:.|...|...||.|:..||  :.|..:...|.|||.:|::|||..:.
Mouse    95 AGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNF--LPTTGTKLTKQQLILARDILEIGAQW 157

  Fly    67 SITIKDYAAFERYMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADFHIELERLPTAL 131
            ||..||..:||||||||..||:||.:.|..|.:|::.:|||||::|:.||:|:||.||||||...
Mouse   158 SILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKD 222

  Fly   132 LLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNTAREEIASCMEKSYLKMAP 196
            :..:.:|:..::||.|.|||.|||:..||.::|:|.|:.|:|||::|.|:|||.|:||:|.|:. 
Mouse   223 IQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKIL- 286

  Fly   197 KLAAQRLGLRPGSKELFELATKRQWCLDEEGNYDYAGLHTRPMEK-VPAKDIATHNLTYAQELEK 260
            ...|.|:......|::.:.|.||.|.|.....|.:|....:|.:. :|:.::|...:.||::||.
Mouse   287 FAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEM 351

  Fly   261 IV 262
            ||
Mouse   352 IV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn12RNP_996086.1 CSN8_PSD8_EIF3K 98..228 CDD:287089 55/129 (43%)
Psmd8NP_080821.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
CSN8_PSD8_EIF3K 204..318 CDD:287089 48/114 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2152
OMA 1 1.010 - - QHG53806
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003512
OrthoInspector 1 1.000 - - otm42720
orthoMCL 1 0.900 - - OOG6_102164
Panther 1 1.100 - - O PTHR12387
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1201
SonicParanoid 1 1.000 - - X2884
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.