DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn12R and PSMD8

DIOPT Version :9

Sequence 1:NP_996086.1 Gene:Rpn12R / 2768973 FlyBaseID:FBgn0036465 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_002803.2 Gene:PSMD8 / 5714 HGNCID:9566 Length:350 Species:Homo sapiens


Alignment Length:262 Identity:108/262 - (41%)
Similarity:166/262 - (63%) Gaps:4/262 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNLYTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQKDQLIKSREMLEIAVEH 66
            :.:|.:||.||::.:|||:.|...|...||.|:..||  :.|..:...|.|||.:|::|||..:.
Human    92 TGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNF--LPTTGTKLTKQQLILARDILEIGAQW 154

  Fly    67 SITIKDYAAFERYMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADFHIELERLPTAL 131
            ||..||..:||||||||..||:||.:.|..|.:|::.:|||||::|:.||:|:||.||||||...
Human   155 SILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKD 219

  Fly   132 LLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNTAREEIASCMEKSYLKMAP 196
            :..:.:|:..::||.|.|||.|||:..||.::|:|.|:.|:|||::|.|:|||.|:||:|.|:. 
Human   220 IQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKIL- 283

  Fly   197 KLAAQRLGLRPGSKELFELATKRQWCLDEEGNYDYAGLHTRPME-KVPAKDIATHNLTYAQELEK 260
            ...|.|:......|::.:.|.||.|.|.....|.:|....:|.: .:|:.::|...:.||::||.
Human   284 FTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEM 348

  Fly   261 IV 262
            ||
Human   349 IV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn12RNP_996086.1 CSN8_PSD8_EIF3K 98..228 CDD:287089 55/129 (43%)
PSMD8NP_002803.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
CSN8_PSD8_EIF3K 201..315 CDD:370807 48/114 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144953
Domainoid 1 1.000 83 1.000 Domainoid score I8350
eggNOG 1 0.900 - - E1_KOG3151
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2152
OMA 1 1.010 - - QHG53806
OrthoDB 1 1.010 - - D1183195at2759
OrthoFinder 1 1.000 - - FOG0003512
OrthoInspector 1 1.000 - - otm40647
orthoMCL 1 0.900 - - OOG6_102164
Panther 1 1.100 - - O PTHR12387
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1201
SonicParanoid 1 1.000 - - X2884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.