DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn12R and psmd8

DIOPT Version :9

Sequence 1:NP_996086.1 Gene:Rpn12R / 2768973 FlyBaseID:FBgn0036465 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_012823709.1 Gene:psmd8 / 448645 XenbaseID:XB-GENE-961854 Length:310 Species:Xenopus tropicalis


Alignment Length:263 Identity:110/263 - (41%)
Similarity:164/263 - (62%) Gaps:4/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNLYTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQKDQLIKSREMLEIAVE 65
            ::.:|.:||.||:|..|||:.|..:|...||.|:..||  :.|......|.|||.:|::|||..:
 Frog    51 LAAMYEQLKAEWAKKNPNLSKCGDVLGKLKLALLEQNF--LPTTDVKLTKQQLILARDILEIGAQ 113

  Fly    66 HSITIKDYAAFERYMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADFHIELERLPTA 130
            .||..||..:||||||||..||:||...|..|.:.::.:|||||::|:.||:||||.||||||..
 Frog   114 WSILKKDIPSFERYMAQLKCYYFDYKDELPESAYKHQLLGLNLLFLLSQNRVADFHTELERLPAK 178

  Fly   131 LLLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNTAREEIASCMEKSYLKMA 195
            .:..:.:|:..::||.|.|||.|||:..||.::|:|.|:.|:|||::|.|:|||.|:||:|.|:.
 Frog   179 DIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIADCIEKAYGKIL 243

  Fly   196 PKLAAQRLGLRPGSKELFELATKRQWCLDEEGNYDYAGLHTRPME-KVPAKDIATHNLTYAQELE 259
            ...|.:.|.... .|::.|.|.||.|.|....|:.::.....|.| .:|:.::|...:.||::||
 Frog   244 FNEATRILFFNT-PKKMTEYAKKRGWVLGPNNNFSFSSQQQNPEEVTIPSTELAKQVIEYARQLE 307

  Fly   260 KIV 262
            .||
 Frog   308 MIV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn12RNP_996086.1 CSN8_PSD8_EIF3K 98..228 CDD:287089 56/129 (43%)
psmd8XP_012823709.1 CSN8_PSD8_EIF3K 161..276 CDD:370807 50/115 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53806
OrthoDB 1 1.010 - - D1183195at2759
OrthoFinder 1 1.000 - - FOG0003512
OrthoInspector 1 1.000 - - otm47824
Panther 1 1.100 - - O PTHR12387
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.