DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn12R and rpn-12

DIOPT Version :9

Sequence 1:NP_996086.1 Gene:Rpn12R / 2768973 FlyBaseID:FBgn0036465 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_496489.1 Gene:rpn-12 / 174786 WormBaseID:WBGene00004468 Length:250 Species:Caenorhabditis elegans


Alignment Length:263 Identity:80/263 - (30%)
Similarity:145/263 - (55%) Gaps:14/263 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNLYTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQKDQLIKSREMLEIAVE 65
            ||..:..|...|:|...:|....:.|:    ||.:    .:..:|....|...:.|:::.||:|.
 Worm     1 MSAAHKNLLAVWAKEPKDLVAVEKALN----ELTK----VLSASSDLNDKQSALASKDLYEISVL 57

  Fly    66 HSITIKDYAAFERYMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADFHIELERLPTA 130
            .:|...|:..|:.|:.|::||   |....|:|::.:...||:|:::||.|||:|||:.||::|..
 Worm    58 LAILKHDFETFDDYINQMHTY---YTMAPENSENKHLMTGLHLMFLLAANRLSDFHMLLEQIPQK 119

  Fly   131 LLLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNTAREEIASCMEKSYLKMA 195
            ....:::|...:.:|...|||.|||::..:|::||..|:.|:.|:::|.|.|||:.:|||:..:.
 Worm   120 EQTSNAYISTPVRIEQSLMEGAYNKVVLTEKNIPSPFYTIFIRIMLDTIRREIATSIEKSFKVLT 184

  Fly   196 PKLAAQRLGLRPGSKELFELATKRQWCLD-EEGNYDYAGLHTRPMEKVPAKDIATHNLTYAQELE 259
            .|.|...| |....:::.:...:|:|.|| |...::......:|: .:....:||..|.||::||
 Worm   185 AKDATVML-LFDNDEQMKKFGQERKWHLDGERYVFEIEVAQEKPV-NLDTVRVATQTLFYAKQLE 247

  Fly   260 KIV 262
            :||
 Worm   248 QIV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn12RNP_996086.1 CSN8_PSD8_EIF3K 98..228 CDD:287089 45/130 (35%)
rpn-12NP_496489.1 CSN8_PSD8_EIF3K 87..218 CDD:287089 45/131 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158442
Domainoid 1 1.000 97 1.000 Domainoid score I4543
eggNOG 1 0.900 - - E1_KOG3151
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I3080
Isobase 1 0.950 - 0 Normalized mean entropy S2152
OMA 1 1.010 - - QHG53806
OrthoDB 1 1.010 - - D1183195at2759
OrthoFinder 1 1.000 - - FOG0003512
OrthoInspector 1 1.000 - - otm14733
orthoMCL 1 0.900 - - OOG6_102164
Panther 1 1.100 - - O PTHR12387
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1201
SonicParanoid 1 1.000 - - X2884
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.