DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33490 and CG32086

DIOPT Version :9

Sequence 1:NP_996047.1 Gene:CG33490 / 2768970 FlyBaseID:FBgn0053490 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_729720.1 Gene:CG32086 / 326195 FlyBaseID:FBgn0052086 Length:491 Species:Drosophila melanogaster


Alignment Length:540 Identity:221/540 - (40%)
Similarity:304/540 - (56%) Gaps:62/540 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANIGRYIERNPGIRAAGLTSTVQFNGA---KDCLFVVSLEEEAEDRIRALCRRSRPKPAKRTPK 62
            |||.|.:|:||..|..||| ||...:||   |.||.:.:.||.||    :|.||:..:..|::.|
  Fly     1 MANKGHFIDRNANIPTAGL-STSGLDGAEGVKVCLSISNPEELAE----SLVRRNYGQINKKSQK 60

  Fly    63 L------PTHQIGDILNNE-NPGLFAELQNKFRENMFHKKPGLGEARETNSKPSYVTNLSHTFGK 120
            .      |:..|.|:|.:| ....|...:.||.|.|:.||..||..::|.|||..|||:|.|||.
  Fly    61 FPAGSVQPSSSIRDLLTSELQKSRFMSFKEKFYEEMYFKKATLGGVKKTYSKPEDVTNISQTFGS 125

  Fly   121 ITQSNCNDSLYSIVLPPKSAEQVNREYGEYHDKHIISHNHYFPAEQINRRYSKPFNRFNTFGLPP 185
            .:..:.|:.||.::||.|||||||:||..:|||:|||||||||:||:||||::||:|.:..|...
  Fly   126 PSSQSQNECLYDVILPAKSAEQVNKEYEAFHDKYIISHNHYFPSEQVNRRYAQPFDRKSPCGDIH 190

  Fly   186 TLDPSGIKMKHCLEEGEEHLKIVKKPQKDIDDRTKGPLGKKYSWYPYQIPENMTFGRTLPRETDV 250
            |....|:|:|.||||||.|||::.|.|.|..||.:.|||.:...|.:.:|: :|||..|....||
  Fly   191 THGDFGLKVKRCLEEGENHLKVIGKAQVDFMDRNEAPLGMRNKKYTFAVPD-ITFGVPLRSNGDV 254

  Fly   251 RSLLEYTSPSIKSEKLAIAVSHLNMLRKMLQERDDFNMNQVISALGKKDTEGQRQLPLDEVINVL 315
            :.||....|..|:.:|..|:.:||..|..|:.:.:|:...:.|.|.:.||:|...|||..::.:.
  Fly   255 KMLLNNIEPCYKTNRLLDAIRYLNKKRHSLRNQLEFHKYALNSVLERSDTDGTGHLPLARILEIF 319

  Fly   316 HKLSIPADAEKIRNAASHFQLFVDEGCCSEKVKYEELCDLLSILKSLPLIGSITPMPKVTYNQDT 380
            ....|..||:|||.|.|:|:|.|||||.:|:|.|.:...||||..|||..|::|.:..|:. .||
  Fly   320 RSFHIRLDAQKIRLALSNFRLIVDEGCATERVNYVDFFRLLSIQNSLPKTGNLTNVSDVSC-LDT 383

  Fly   381 AYRQLCADLMKKPPEGPQFKTAKKASIKQDMNAAPFKDFNSPQKAPIEQDMDETRSRDYKTSQKT 445
            .||.|||||..|               .:|...|            |.|:::..     ||:.| 
  Fly   384 TYRLLCADLQNK---------------SKDNTGA------------ISQNLEGN-----KTTAK- 415

  Fly   446 PIQQDMDDTRVGDVINPEFSTLCGLWPSDFKALRSKDEIERIFKDIVSKEDFQTIWLSLMDEQKD 510
                        |:|.|:.:.|.||..|||..||.|.||||||:.:|:.:.|:.||.|||.:.||
  Fly   416 ------------DLITPDLAILRGLTHSDFTCLRPKAEIERIFRSLVTTDKFEAIWQSLMTKFKD 468

  Fly   511 QNEMASVAQFRAQMKKNIES 530
            |||||||.|||.:|...||:
  Fly   469 QNEMASVTQFRTEMHNKIEA 488



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469560
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJU2
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5047
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27233
OrthoDB 1 1.010 - - D1016066at2759
OrthoFinder 1 1.000 - - FOG0016707
OrthoInspector 1 1.000 - - otm42829
orthoMCL 1 0.900 - - OOG6_104929
Panther 1 1.100 - - P PTHR12086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.