DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33490 and Efhc1.1

DIOPT Version :9

Sequence 1:NP_996047.1 Gene:CG33490 / 2768970 FlyBaseID:FBgn0053490 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_573075.1 Gene:Efhc1.1 / 32528 FlyBaseID:FBgn0030691 Length:793 Species:Drosophila melanogaster


Alignment Length:385 Identity:75/385 - (19%)
Similarity:130/385 - (33%) Gaps:99/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RYIERNPGIRAAGLTSTVQFNGAKDCLFVVSLEEEAEDRIRALCRRSRPKPAKRTPKLPTHQIGD 70
            ||:.|    ..|.:.||::.|..:  :||:|.         .||.             .|.||.:
  Fly   432 RYVLR----FGAKMLSTIKANCER--IFVISY---------YLCD-------------DTLQIQE 468

  Fly    71 ILNNENPGLFAELQNKFRENMFHKKPGLGEARETNSKPSYVTNLSHTFGKITQSNCNDSLYSIVL 135
            |....:..|..|...:.|..:    |  |:.|.:..:|.|....:...|  :..:..|.::.|| 
  Fly   469 IAVRNSGFLGGEFMKRTRLEL----P--GQERFSCKQPQYYMPWNFFVG--STMSLKDFIFHIV- 524

  Fly   136 PPKSAEQVNREYGEYHDKHIISHNHYFPAEQI----NRRYSKPFNRFNTFGLPPTLDPSGIKMKH 196
               ||::....|.|:|.:       .||...:    .:..|...||...|......|.:.::.|.
  Fly   525 ---SADEYTLMYMEHHPE-------IFPHANVGVIMEKVKSALQNRMAEFVGSCVPDCTDLEKKR 579

  Fly   197 CLEEGEEHLK--IVKKPQKDIDDRTKGPLGKKYSWYPYQIPENMTFGRTLPRETDVRSLLEYTSP 259
            .:....|..|  ::......|.|.....|.:.:|                         .|.:.|
  Fly   580 DVFVSFESFKGALISIMGNQISDHEIISLCRHFS-------------------------AEKSQP 619

  Fly   260 SIKSEKLAIAVSHLNMLRKMLQERDDFNMNQVISALGKKDTEGQRQLPLDEVINVLHKLSIPADA 324
            :........|.:||.:.|.:...|||     ::......:...|..||..:|.:.|....:|...
  Fly   620 NACDRSTVRAAAHLELKRTLWNARDD-----LMEHFHHINPTNQPFLPEVKVRSALRGCRLPFSL 679

  Fly   325 EKIRNAASHFQLFVDEGCCSEKVKYEELCDLLSIL--------KSLPLIGSITPMPKVTY 376
            |.|.|..|    .::...|.:    .|:|||::.:        ..||:..:....||:.:
  Fly   680 ELIDNILS----ILNRNECDD----IEVCDLMNFIDVSCGKGCDMLPVNHAFELCPKIPF 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33490NP_996047.1 None
Efhc1.1NP_573075.1 DM10 82..189 CDD:128921
DUF1126 110..142 CDD:284078
DM10 232..370 CDD:128921
DUF1126 256..288 CDD:284078
DM10 431..538 CDD:128921 32/145 (22%)
DUF1126 454..486 CDD:284078 10/53 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12086
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.