Sequence 1: | NP_996136.2 | Gene: | CG33288 / 2768968 | FlyBaseID: | FBgn0053288 | Length: | 1115 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_291050.1 | Gene: | Rcc1l / 94254 | MGIID: | 2137600 | Length: | 461 | Species: | Mus musculus |
Alignment Length: | 269 | Identity: | 59/269 - (21%) |
---|---|---|---|
Similarity: | 95/269 - (35%) | Gaps: | 72/269 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 KSHLAENTQSYFYIKNDPVKRLISGPNQSAVICESGRLFVWGENHYGQLGIGGH---------GG 69
Fly 70 ------------------ASGKKGGGSHNGNGDI-----VTKPTCVKALKTLGL----KICDVAF 107
Fly 108 GNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVDQQPCAIIRKPFRLEEFDDYLSKNEETD 172
Fly 173 NFMTVQAGKEHFAVLTTTGRLIGCGSNAQ--LQLGELEADY-------DGHPVEIRLDAPVQQFT 228
Fly 229 CGPESTLVL 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33288 | NP_996136.2 | ATS1 | 5..>260 | CDD:227511 | 59/269 (22%) |
Rcc1l | NP_291050.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..35 | ||
RCC1 1. /evidence=ECO:0000255 | 55..121 | ||||
RCC1 2. /evidence=ECO:0000255 | 125..188 | ||||
RCC1 | 127..186 | CDD:278826 | |||
RCC1_2 | 173..202 | CDD:290274 | |||
RCC1 3. /evidence=ECO:0000255 | 190..244 | 6/32 (19%) | |||
RCC1 | 192..242 | CDD:278826 | 6/30 (20%) | ||
RCC1_2 | 229..258 | CDD:290274 | 5/28 (18%) | ||
RCC1 4. /evidence=ECO:0000255 | 245..297 | 9/51 (18%) | |||
RCC1 | 245..295 | CDD:278826 | 8/49 (16%) | ||
RCC1 5. /evidence=ECO:0000255 | 298..350 | 14/51 (27%) | |||
RCC1 | 298..348 | CDD:278826 | 13/49 (27%) | ||
RCC1 6. /evidence=ECO:0000255 | 352..408 | 14/69 (20%) | |||
RCC1_2 | 393..422 | CDD:290274 | 10/35 (29%) | ||
RCC1 7. /evidence=ECO:0000255 | 409..458 | 15/57 (26%) | |||
RCC1 | 409..452 | CDD:278826 | 14/51 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167849174 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |