DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and rcbtb2

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:XP_005173422.1 Gene:rcbtb2 / 794652 ZFINID:ZDB-GENE-071016-3 Length:527 Species:Danio rerio


Alignment Length:322 Identity:72/322 - (22%)
Similarity:112/322 - (34%) Gaps:87/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KRLIS-----GPNQSAVICESGRLFVWGENHYGQLGIG--GHGGASGKKGGGSHNGNGDIVTKPT 90
            |::||     ||: ..:....|.::.||.|.|.|||.|  .||                  ..|.
Zfish    74 KKIISLSYGTGPH-VVIATADGEVYAWGHNGYSQLGNGTTNHG------------------LTPA 119

  Fly    91 CVKALKTLGLKICDVAFGNHWAVMLTHSNEIFFTGRNIF-----------PEDTHVAQHFTSAQV 144
            .| :...:|.::.:|:.|:|..:.||...|::..|.|..           |....|:....:..|
Zfish   120 LV-STNLIGKRVTEVSCGSHHTIALTTDGEVYAWGYNNSGQVGSGSTANQPTPRRVSSCLQNKVV 183

  Fly   145 DQQPCAIIRKPFRLEEFDDY-------------LSKNEETD---------NFMTVQAGKEHFAVL 187
            ....|..:.....|:..:.|             .:.|::|.         |.:.|..|..|...|
Zfish   184 VNIACGQLCSMAVLDNGETYGWGYNCNGQLGLGNNGNQQTPCRIAALQGINIIQVACGYAHTLAL 248

  Fly   188 TTTGRLIGCGSNAQLQLGELEADYDGHPVEIRLDAP--VQQFTCGPEST-LVLTATGNLFLTG-- 247
            |..|.:...|:|:..|||.........|..|.:|..  |:...|....| ...|.:|.:.:.|  
Zfish   249 TDEGFVYSWGANSYGQLGTGNKSNQAVPTLINMDKERMVEVAACHTSHTSAAKTQSGQVLMWGQC 313

  Fly   248 --------HLNEF-----VFPRFTELQKNLPPTEAIIFMHISKTSEVYIVTNAGSIYRSFES 296
                    ||..|     ||..|.        |.|:.:..:|...:.|: |.|.|:.|.|:|
Zfish   314 RGQAVAYPHLTHFTSTDDVFACFA--------TPAVTWHLLSVDGDDYL-TVAQSLKREFDS 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 62/284 (22%)
rcbtb2XP_005173422.1 RCC1 40..89 CDD:278826 5/15 (33%)
RCC1 93..143 CDD:278826 17/68 (25%)
RCC1 146..196 CDD:278826 7/49 (14%)
RCC1 199..248 CDD:278826 7/48 (15%)
RCC1 251..299 CDD:278826 12/47 (26%)
BTB 364..460 CDD:279045 2/3 (67%)
BTB 371..463 CDD:197585
SPOP_C_like 463..521 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.