DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and rcc1l

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_001076272.1 Gene:rcc1l / 555972 ZFINID:ZDB-GENE-060526-370 Length:451 Species:Danio rerio


Alignment Length:286 Identity:59/286 - (20%)
Similarity:99/286 - (34%) Gaps:72/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SGAIFTLGK------------------SHLAENTQSYFYIKNDPVKRLISGPNQSAVICESGRLF 52
            |..:|::|.                  ||:....:.:    :..|.::..|.:.|..:.:.|.:|
Zfish   179 SEGVFSMGSNTFGQCGRKIVEDEVYSGSHVVHKIEGF----DSRVIQVACGQDHSLFLTDRGSVF 239

  Fly    53 VWGENHYGQLGIGGHGGAS------GKKGGGSHN---------------------GNGDI----- 85
            ..|....||.|:|.|..||      |...|.:..                     ||.:.     
Zfish   240 ACGWGADGQTGLGHHNKASCPVPVGGDLAGVTVQQVATYGDCSLAVSTDGQVFGWGNSEYLQLAS 304

  Fly    86 VTKPTCVKALKTLGLK----ICDVAFGNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVDQ 146
            ||:.|.:.:.:.|.||    |...|.|.....:|....::|..|..|..:...:::   ||..::
Zfish   305 VTESTQISSPRLLPLKGVGRIRQAACGGTQVAVLNEDGDVFVWGFGILGKGPKLSE---SAIPER 366

  Fly   147 QPCAIIRKPFRLEEFDDYLSKNEETDNFMTVQAGKEHFAVLTTTGRLIGCGSNAQLQLGELEADY 211
            .|...    |...||:       .|....:::.|..|||.:|..|.|...|.|.:..||..:.|.
Zfish   367 VPATF----FGRSEFN-------PTVKVASIRCGLSHFAAVTDGGELFVWGKNVRGCLGIGKHDD 420

  Fly   212 DGHPVEIRLDAPVQQFTCGPESTLVL 237
            ...|..:.:...|....||.:..:.|
Zfish   421 QYFPWRVTVPGHVTDVACGVDHMVAL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 59/286 (21%)
rcc1lNP_001076272.1 RCC1 52..108 CDD:278826
RCC1_2 165..192 CDD:290274 3/12 (25%)
RCC1 182..232 CDD:278826 7/53 (13%)
RCC1_2 219..248 CDD:290274 6/28 (21%)
RCC1 236..285 CDD:278826 12/48 (25%)
RCC1 288..338 CDD:278826 11/49 (22%)
RCC1_2 383..412 CDD:290274 9/28 (32%)
RCC1 400..446 CDD:278826 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.